PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G12930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 678aa    MW: 73524 Da    PI: 9.4608
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G12930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.72.6e-41387463278
                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   CqvegC++dls+ak+yhr+h+vCe hskap+v+v+gle+rfCqqCsrfh l+efD++krsCrrrL++hn+rrrk+q+
  OB02G12930.1 387 CQVEGCNVDLSSAKTYHRKHRVCEPHSKAPKVVVAGLERRFCQQCSRFHGLTEFDQKKRSCRRRLNDHNARRRKPQP 463
                   **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.1E-34379448IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.496384461IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-39385466IPR004333Transcription factor, SBP-box
PfamPF031106.1E-32387460IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MKEVEKARRL RSPTPRAAAS VSGMKNLLRK PKDDLQFLQL QPSVSHQKCT NAKQREHHLS  60
TTTQRQPLRL LVLCKDGLEE QKLSVTLTRS REKGSGRGIC MHQLCNEIPS SVQTADYREV  120
SYSFPEKVLI FHHCLPGKIV LQEDTDSCGK RGSSTGLVDI VVFKVRESLE REDIPRRRNS  180
GICCAPFLWE GSKGRLEQQP GSVIGMCSFG MDWNQKSSVL WDWENMPPTG NNTNDNPKNV  240
MHAESKLAVV GVDIGHESAH SSGGTFSSSS EIGYGSSKSS MSVSTGSPSK VGKTIELNFA  300
SVEEPGKNMG KGKCKVDDTG TSRSSVVAAS RAEPLIGLKL GKRTYFEDVC GGQNVKSSPS  360
GVSAATPSPG LAKKAKVAQQ NAPNPYCQVE GCNVDLSSAK TYHRKHRVCE PHSKAPKVVV  420
AGLERRFCQQ CSRFHGLTEF DQKKRSCRRR LNDHNARRRK PQPEAISLSS SRLSTILYGD  480
ARQQTGLLYG QAPYGQMGSC ANSSWDPVPG GFKFTVTKAP WSKPTRTAGV DGTHVSNQQA  540
PSNVLPHGAH HSFDGLMAFK ETNVKVLNQG MEASAAASSS AGGPDFERAL SLLSINSVGA  600
SNLQPGSQMH PSVAAIAGTS NPVMMPSSPA IWQGCLSLDQ QAQFQVFDRL GSDDDATPQQ  660
LQLPKPPPYG SSQYDQMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-283874601184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1442459KKRSCRRRLNDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2429840.0AK242984.1 Oryza sativa Japonica Group cDNA, clone: J090094N03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646870.10.0PREDICTED: squamosa promoter-binding-like protein 3
SwissprotA2X0Q60.0SPL3_ORYSI; Squamosa promoter-binding-like protein 3
SwissprotA3A2Z80.0SPL3_ORYSJ; Squamosa promoter-binding-like protein 3
TrEMBLJ3L9H60.0J3L9H6_ORYBR; Uncharacterized protein
STRINGOB02G12930.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36973776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.38e-41squamosa promoter binding protein-like 2